PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_08B2BB48F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 346aa    MW: 38402.8 Da    PI: 9.1438
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_08B2BB48F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.42.8e-072182631762
                            HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                            A+rsR RK+++i+eLe kv++L++e  +   e+e l+++   l+ e
  Traes_4BS_08B2BB48F.1 218 AQRSRVRKLQYIAELEGKVQSLQSEGIEVSAEMEFLTQQNIMLDLE 263
                            89***********************999999999888887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-6207266IPR004827Basic-leucine zipper domain
CDDcd147038.26E-15208258No hitNo description
SuperFamilySSF579592.38E-6217260No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-7218260No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MMMANAKLQK QALLPPRSPF PTAASPSPYA DHGPIARPQG ATHHRFGHGH GHGHHQRTSS  60
ESIIEEQPSW LDDLLDEPET PVRRAGHRRS SSDSFALFDG SAASGAFANG FEEMGGGGQA  120
APWGGVQEYY AKPSSYGRPQ GRPWEQGMPN LAGYRPGPPV LVREKLGGHH GPLSASRDHE  180
HAMDKRALDE LGAERKEGVL PKYAQSEADT KRAKQQYAQR SRVRKLQYIA ELEGKVQSLQ  240
SEGIEVSAEM EFLTQQNIML DLENKALKQR LESIAQEQVI KRVQQEMFER EIGRLRSLYQ  300
QQQQPPQPPT LARSNSRDLD SQFASMSLKH KDPNSGRDAV SGPLRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2666890.0GQ266689.1 Triticum aestivum bZIP type transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577697.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLW5E8Z20.0W5E8Z2_WHEAT; Uncharacterized protein
STRINGBRADI4G22130.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-48bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]